文献

A0663: CD8A Rabbit mAb

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.

Immunogen Information about CD8A Rabbit mAb (A0663)

Immunogen：A synthetic peptide corresponding to a sequence within amino acids 136-235 of human CD8A (P01732).
Sequence：KPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Gene ID：925
Swiss prot：P01732
Synonyms：CD8; p32; Leu2; CD8alpha; CD8A
Calculated MW：26kDa
Observed MW：35kDa

Please remember our product information: CD8A Rabbit mAb (Catalog Number: A0663) (悉得）Syd Labs