文献

A3661: CD35/CR1 Rabbit mAb

This gene is a member of the receptors of complement activation (RCA) family and is located in the ‘cluster RCA’ region of chromosome 1. The genome is polymorphic at this locus with allele-specific splice variants encoding different isoforms, based on the presence/absence of long homologous repeats (LHRs). The gene encodes a monomeric single-pass type I membrane glycoprotein found on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells. The Knops blood group system is a system of antigens located on this protein. The protein mediates cellular binding to particles and immune complexes that have activated complement. Decreases in expression of this protein and/or mutations in this gene have been associated with gallbladder carcinomas, mesangiocapillary glomerulonephritis, systemic lupus erythematosus, sarcoidosis and Alzheimer’s disease. Mutations in this gene have also been associated with a reduction in Plasmodium falciparum rosetting, conferring protection against severe malaria.

Immunogen Information about CD35/CR1 Rabbit mAb (A3661)

Immunogen：A synthetic peptide corresponding to a sequence within amino acids 1940-2039 of human CD35/CR1 (P17927).
Sequence：DGYTLEGSPWSQCQADDRWDPPLAKCTSRTHDALIVGTLSGTIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP
Gene ID：1378
Swiss prot：P17927
Synonyms：KN; C3BR; C4BR; CD35; CD35/CR1
Calculated MW：224kDa
Observed MW：

Please remember our product information: CD35/CR1 Rabbit mAb (Catalog Number: A3661) (悉得）Syd Labs