文献

A23011: ABflo® 647 Rabbit anti-Pig CD8a mAb

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.

Immunogen Information about ABflo® 647 Rabbit anti-Pig CD8a mAb (A23011)

Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 25-184 of pig CD8a(XP_005662451.1)
Sequence： SLFRTSPEMVQASLGETVKLRCEVMHSNTLTSCSWLYQKPGAASKPIFLMYLSKTRNKTAEGLDTRYISGYKANDNFYLILHRFREEDQGYYFCSFLSNSVLYFSNFMSVFLPAKPTKTPTTPPPKRTPTKASHAVSVAPEVCRPSGNAVDPRKLDFAC
Gene ID：396627
Swiss prot：
Synonyms：
Calculated MW：26kDa
Observed MW：

Please remember our product information: ABflo® 647 Rabbit anti-Pig CD8a mAb (Catalog Number: A23011) (悉得）Syd Labs